PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G170400.1
Common NamePHAVU_002G170400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 359aa    MW: 40538.7 Da    PI: 8.5783
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G170400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.21.4e-20953145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        kr en+  rq t++kR+ngi+KKA ELS+LCd+++ +++f+++gk
  Phvul.002G170400.1  9 KRLENTNGRQATYAKRKNGIMKKAAELSILCDIDIILLMFAPNGK 53
                        689****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.507153IPR002100Transcription factor, MADS-box
CDDcd001205.81E-24256No hitNo description
SuperFamilySSF554553.14E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-16323IPR002100Transcription factor, MADS-box
PfamPF003199.4E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRVKLKIKR LENTNGRQAT YAKRKNGIMK KAAELSILCD IDIILLMFAP NGKPSVCRGR  60
RSNLEEVIAK FAQLTPQERA KRKLETLEAL KKTFKKLDHD VNIQEFLGTS SQTIEDLSNQ  120
ARLLQSQISE THKRLSYWTE FDKITNVEQL GQMENSLRES LNQIRTRKEN IKKQQLVSLQ  180
CNNQFNEMNI PFRMSAEQHL QPLSWIANGD SQNIVLPEDS SMFIHKDVEG SASSSFGSYA  240
SYLGSSMKNE MSNSAQENGV LSDMSSTANM RLQLNGQFPY LPYNFNLLNN LKFQPTAEIN  300
PHENPVDYQV NGSLEAPRSG YDSNHHGWAS TSGHCGVTMF DEQLYAQASS TKIHFGFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-12192190Myocyte-specific enhancer factor 2B
1tqe_Q2e-12192190Myocyte-specific enhancer factor 2B
1tqe_R2e-12192190Myocyte-specific enhancer factor 2B
1tqe_S2e-12192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158646.10.0hypothetical protein PHAVU_002G170400g
SwissprotQ1PFA41e-110AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLV7CN290.0V7CN29_PHAVU; Uncharacterized protein
STRINGGLYMA07G35610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.23e-86AGAMOUS-like 30